DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Ovch2

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:292 Identity:87/292 - (29%)
Similarity:135/292 - (46%) Gaps:39/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPE--------TRVIGGVDSPTGFAPYQVSIM 60
            |:||..:|.|.|..::::...|.......|  |||:        :|::||.....|..|:|||:.
Mouse     8 LILILGMVCLEQGHSETLSSIRNPDCGQSL--VKPQPQNYFSLFSRIVGGSQVEKGSYPWQVSLK 70

  Fly    61 NTFGEHVCGGSIIAPQWILTAAHCM--EWPIQYLKIVTGTVDYTR--PGAEYL-VDGSKIH--CS 118
            .. .:|:|||:||:.||::||||||  ......|.:..|..|.::  ||.:.| ::...||  .|
Mouse    71 QK-QKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQTLAIETIIIHPQFS 134

  Fly   119 HDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKID 183
            ..||..: ||||:..|....:....:|:.|...|.....|...|..|||.....||....||:::
Mouse   135 TRKPMIY-DIALLKMAGTFQFGQFVRPVCLPEPGEHFNAGFICTTAGWGRLSEGGRLPQVLQQVN 198

  Fly   184 LNYIDHDNCQS---RVRNANWLSEGHVCTFTQE-GEGSCHGDSGGPLVDANQ----TLVGVVNWG 240
            |..:..:.|::   .::|. ...:..:||.:.: |..:|.|||||.|:..|:    ||.||.:||
Mouse   199 LPILTQEECEAVLLTLKNP-ITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLAGVTSWG 262

  Fly   241 EACA-----------IGYPDVFGSVAYYHDWI 261
            ..|.           .|.|.:|..:.....||
Mouse   263 LGCGRSWRNNARKKEQGSPGIFTDLRRVLPWI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 74/245 (30%)
Tryp_SPc 42..263 CDD:238113 75/246 (30%)
Ovch2NP_766496.2 Tryp_SPc 51..294 CDD:214473 74/245 (30%)
Tryp_SPc 52..297 CDD:238113 75/246 (30%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.