DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Prss38

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:280 Identity:87/280 - (31%)
Similarity:128/280 - (45%) Gaps:33/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LISVLVILSQCSAKSVKIHRRH---QLNHHLGHV---KP--ETRVIGGVDSPTGFAPYQVSIMNT 62
            |:..|::.|.....||.  |||   |.|...|.|   :|  :.:::||..:.....|:||| ::.
Mouse    14 LLFPLLLASPTWVTSVS--RRHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVS-LHY 75

  Fly    63 FGEHVCGGSIIAPQWILTAAHCME--WPIQYLKIVTGTVDYTRPGAE------YLVDGSKIHCSH 119
            .|.|:|||||::..|:|:||||.:  ..::...|..|..:..:....      |.|   .||.:.
Mouse    76 SGFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEKANRHTQWFEIYQV---IIHPTF 137

  Fly   120 DKPAYH---NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQK 181
            .  .||   .|:||:.....||:.|...||.| ....|..:......||||.....|....:|.:
Mouse   138 Q--MYHPIGGDVALVQLKSAIVFSDFVLPICL-PPSDLYLINLSCWTTGWGMISPQGETGNELLE 199

  Fly   182 IDLNYIDHDNCQSRVRNANWLSEGHVCTF-TQEGEGSCHGDSGGPLV-DANQT--LVGVVNWGEA 242
            ..|..|....||.....:::|....:|.. .:..:..|.||||.||| ..|||  .:|:|:||..
Mouse   200 AQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRG 264

  Fly   243 CAIG-YPDVFGSVAYYHDWI 261
            ||.. ||.||.:|:|:..||
Mouse   265 CAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/235 (31%)
Tryp_SPc 42..263 CDD:238113 74/236 (31%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 74/234 (32%)
Tryp_SPc 58..284 CDD:214473 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.