DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and try-5

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:270 Identity:68/270 - (25%)
Similarity:98/270 - (36%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TRVIGGVDSPTGFAPYQVSI-----MNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLK------ 93
            |...|...:||..||:.|.|     ...| |.:|||::|..:.:||||||.:......|      
 Worm    41 TDAAGNTGNPTHLAPWAVQIRVKARKGDF-EVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEEN 104

  Fly    94 -----------------IVTGTV-----DYTRPGAEY------------------LVDGSKIHCS 118
                             |:|.||     ..||...:|                  :.|..|.||.
 Worm   105 SMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCE 169

  Fly   119 HDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKV----GDKLTLTGWGSTKTWGRYST-- 177
            ..     |||.::.....|  ||: :....|....||:|    |..:|..||||....|..:.  
 Worm   170 QG-----NDIVILELESTI--DDV-EGANYACLPFLPEVNIQSGANVTSFGWGSDPGKGFDNAAF 226

  Fly   178 -QLQKIDLNYIDHDNCQSRVRNANW---LSEGHVCTFTQEGEGSCHGDSGGPLV-----DANQTL 233
             .:|.:.|.......|:.     ||   :.....||..:|.:..|.|||||.|.     .|.:.:
 Worm   227 PMIQVLTLATETLATCEE-----NWGTSIPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFI 286

  Fly   234 VGVVNWGEAC 243
            :.:|::|..|
 Worm   287 IAIVSYGSDC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/269 (25%)
Tryp_SPc 42..263 CDD:238113 67/268 (25%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 65/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.