DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Klk1b4

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:254 Identity:66/254 - (25%)
Similarity:116/254 - (45%) Gaps:40/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IGGVDSP---------TGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCME-----W------ 87
            :||:|:.         ....|:.|::.. |.::.|||.::...|:||||||..     |      
Mouse    12 LGGIDAAPPVQSQVDCENSQPWHVAVYR-FNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKNNF 75

  Fly    88 ----PIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKL 148
                |....::|:..:    |..::.:.....|....:..|.||:.|:..:||....|:.:||.|
Mouse    76 LEDEPSDQHRLVSKAI----PHPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITL 136

  Fly   149 ASKGSLPKVGDKLTLTGWGSTKTWG-RYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQ 212
            .::.  ||:|.....:|||||.... :|...||.::|..:.:::|..  .:...:::..:|....
Mouse   137 PTEE--PKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCDK--AHEMKVTDAMLCAGEM 197

  Fly   213 EGEGS--CHGDSGGPLVDANQTLVGVVNWG-EACA-IGYPDVFGSVAYYHDWIEQMMTD 267
            :| ||  |..||||||: .:..|.|:.:|| |.|. ...|.|:..:..:..||.:.|.:
Mouse   198 DG-GSYTCEHDSGGPLI-CDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMAN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/246 (26%)
Tryp_SPc 42..263 CDD:238113 65/248 (26%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 65/248 (26%)
Activation peptide homolog 18..24 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.