DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and try-10

DIOPT Version :10

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:102 Identity:18/102 - (17%)
Similarity:38/102 - (37%) Gaps:34/102 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 LTIQCVSDMNTKKDALTNLFESERHLHSLPSDQQIVHVEFGAF-----------YHPHSDKLPVP 480
            |::|.:|.:|.::....:|.|      :||....:...::|.:           |:...:.....
 Worm    61 LSLQNISGVNQQEQKERDLIE------NLPGQPSVNFKQYGGYVTVNESAGRSLYYYFVEATNTK 119

  Fly   481 NSA-----------------VYFQLGPFTISFDERTM 500
            ||:                 .:.:||||.:..|.:|:
 Worm   120 NSSPLVLWLNGGPGCSSLYGAFQELGPFRVHSDNKTL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 42..263 CDD:238113
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:473915 14/88 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.