DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CFD

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:237 Identity:67/237 - (28%)
Similarity:109/237 - (45%) Gaps:15/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PETRVIGGVDSPTGFAPYQVSI-MNTFGEHVCGGSIIAPQWILTAAHCMEWPIQ-YLKIVTGTVD 100
            |..|::||.::.....||..|: :|  |.|:|||.::|.||:|:||||:|.... .::::.|...
Human    29 PRGRILGGREAEAHARPYMASVQLN--GAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHS 91

  Fly   101 YTRPGAE---YLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPI--KLASKGSLPKVGDK 160
            .::|...   |.|..:..|.........:|:.|:..::........:|:  :...:...|  |..
Human    92 LSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAP--GTL 154

  Fly   161 LTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGP 225
            ..:.|||.....||....||.:.|..:|...|..|..:...::|..:|..:...: ||.||||||
Human   155 CDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRD-SCKGDSGGP 218

  Fly   226 LVDANQTLVGVVNWG-EACA-IGYPDVFGSVAYYHDWIEQMM 265
            || ....|.|||..| ..|. ...|.::..||.|..||:.::
Human   219 LV-CGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 64/228 (28%)
Tryp_SPc 42..263 CDD:238113 65/229 (28%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 64/228 (28%)
Tryp_SPc 33..258 CDD:238113 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.