DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Klk1b11

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_034770.1 Gene:Klk1b11 / 16613 MGIID:892023 Length:261 Species:Mus musculus


Alignment Length:246 Identity:64/246 - (26%)
Similarity:116/246 - (47%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTG------ 97
            ::|::||.:......|:.|::.. :.:::|||.::...|:||||||   .:....:..|      
Mouse    22 QSRIVGGFNCEKNSQPWHVAVYR-YNKYICGGVLLDRNWVLTAAHC---HVSQYNVWLGKTKLFQ 82

  Fly    98 --------TVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSL 154
                    .|..:.|..:|.:....||....:....||:.|:..::|....|..:||.|.::.  
Mouse    83 REPSAQHRMVSKSFPHPDYNMSLLIIHNPEPEDDESNDLMLLRLSEPADITDAVKPIALPTEE-- 145

  Fly   155 PKVGDKLTLTGWGS-TKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANW-LSEGHVCTFTQ-EGEG 216
            ||:|....::|||| |.|..:....||.:.:..:.::.|   |:|.|. :::..:|.... .|:.
Mouse   146 PKLGSTCLVSGWGSITPTKFQTPDDLQCVSIKLLPNEVC---VKNHNQKVTDVMLCAGEMGGGKD 207

  Fly   217 SCHGDSGGPLVDANQTLVGVVNWGE-ACA-IGYPDVFGSVAYYHDWIEQMM 265
            :|.|||||||: .:..|.|:..||. .|. ...|.|:..:..:.:||:..|
Mouse   208 TCKGDSGGPLI-CDGVLHGITAWGPIPCGKPNTPGVYTKLIKFTNWIKDTM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 61/238 (26%)
Tryp_SPc 42..263 CDD:238113 62/239 (26%)
Klk1b11NP_034770.1 Tryp_SPc 24..253 CDD:214473 61/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.