DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG43124

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:278 Identity:45/278 - (16%)
Similarity:108/278 - (38%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCG 69
            :::.::::..|.||::::       ...:.|::   |:.|     :.:||:...|::. .:.:|.
  Fly     7 IVLCIVLMFYQGSAQTLE-------EDCVDHME---RING-----SSYAPWLAEILSD-SKVICA 55

  Fly    70 GSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTA 134
            |::|...::||||.|.: ..:.|.:..|:..:.:....:.|..:....:|......|::.:....
  Fly    56 GALINNLYVLTAASCFK-ENEKLTVRLGSGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQ 119

  Fly   135 KPIVYDDLTQPIKLASKGSLPK----------VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDH 189
            ..:.:....:|:.:...   ||          :.:|        .|.| .:...::.:...|:..
  Fly   120 TEVEFKTHIRPMCITKS---PKSLGLATTFEIINEK--------PKMW-YFCKNIKGLFCKYVFG 172

  Fly   190 DNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVD--ANQTLVGVVNWGEACAIGYPD--- 249
            :|      ...|.|:                .:|.|..:  :|....|:|.:|   .:.|.|   
  Fly   173 EN------EEKWQSK----------------PTGSPWTETISNGPFKGLVRYG---ILSYRDNKT 212

  Fly   250 ---VFGSVAYYHDWIEQM 264
               |:.:|..:.:||.|:
  Fly   213 YDEVYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 38/237 (16%)
Tryp_SPc 42..263 CDD:238113 39/238 (16%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.