DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Prss29

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:251 Identity:84/251 - (33%)
Similarity:120/251 - (47%) Gaps:33/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIGGVDSPTGFAPYQVSIMN-----TFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDY 101
            ::||..:|.|..|:|||:..     .|..|.||||||.|||:||||||:.     .:....:|..
Mouse    31 IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIR-----ERDADPSVFR 90

  Fly   102 TRPGAEYLVDGSK--------IHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVG 158
            .|.|..||..|.:        ||.........:|:||:..|..:......:|:||.|:.......
Mouse    91 IRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKK 155

  Fly   159 DKLTLTGWGSTKTWGRYST--QLQKIDLNYIDHDNCQSRVRNA--------NWLSEGHVCTFTQE 213
            |...:||||:..|......  :||::.:..||:..|:....||        ..:.:..:|...| 
Mouse   156 DVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQ- 219

  Fly   214 GEGSCHGDSGGPL---VDANQTLVGVVNWGEACAI-GYPDVFGSVAYYHDWIEQMM 265
            |:.||:|||||||   |..:.||||||:||..||: .:|.|:..|..:..||.|.|
Mouse   220 GQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 80/245 (33%)
Tryp_SPc 42..263 CDD:238113 82/247 (33%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 82/248 (33%)
Tryp_SPc 31..271 CDD:214473 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.