DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and KLK11

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:274 Identity:82/274 - (29%)
Similarity:126/274 - (45%) Gaps:57/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCME-WP--------- 88
            |.|..|||:|.|.:......|:|.::... ...:||.::|||:|:||||||:: |.         
Human    46 GLVGGETRIIKGFECKPHSQPWQAALFEK-TRLLCGATLIAPRWLLTAAHCLKPWVSLTSPTHVS 109

  Fly    89 ---------IQYLK--IV-----------------TGTVDYTRPGAEYLVDGSKIHCSHDKPAYH 125
                     :.:|.  ||                 |.|..:..||         .:.|.....:.
Human   110 PDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPG---------FNNSLPNKDHR 165

  Fly   126 NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKT-WGRYSTQLQKIDLNYIDH 189
            |||.|:..|.|:......:|:.|:|:  ....|....::|||||.: ..|....|:..::..|:|
Human   166 NDIMLVKMASPVSITWAVRPLTLSSR--CVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEH 228

  Fly   190 DNCQSRVRNANWLSEGHVCTFTQE-GEGSCHGDSGGPLVDANQTLVGVVNWG-EACAI-GYPDVF 251
            ..|::.....  :::..||...|| |:.||.|||||||| .||:|.|:::|| :.||| ..|.|:
Human   229 QKCENAYPGN--ITDTMVCASVQEGGKDSCQGDSGGPLV-CNQSLQGIISWGQDPCAITRKPGVY 290

  Fly   252 GSVAYYHDWIEQMM 265
            ..|..|.|||::.|
Human   291 TKVCKYVDWIQETM 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/261 (29%)
Tryp_SPc 42..263 CDD:238113 76/262 (29%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 75/261 (29%)
Tryp_SPc 54..303 CDD:238113 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.