DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and LOC103908930

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:263 Identity:88/263 - (33%)
Similarity:125/263 - (47%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCG 69
            |:.::||:...||                    |..::|||.:.|....|:|:.|.|. |:..||
Zfish     4 VVFALLVVNVACS--------------------PVDKIIGGYECPPNSQPWQIYITND-GQRWCG 47

  Fly    70 GSIIAPQWILTAAHCMEWPIQYLKIVTG--TVDYTRPGAEYLVDGSKI--HCSHDKPAYHNDIAL 130
            .|:|...|.::|||| ......|.:..|  .:|.... .|..:...|:  |.....|:..|||.|
Zfish    48 ASLINESWAVSAAHC-NIGANLLTVYLGKHNIDVVEK-TEQRIRTEKVFPHPEFKFPSEDNDIML 110

  Fly   131 IHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSR 195
            |....|.|::...|||.||:  |....|::..::|||.|:. |..|. ||.:||.......|:..
Zfish   111 IKLKDPAVFNQYVQPIPLAT--SCSSEGEQCLVSGWGYTEV-GLPSV-LQCLDLAVQSRQECERV 171

  Fly   196 VRNANWLSEGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFGSVAYYH 258
            .::.  .::..:|. |.:.|:|.|||||||||| .|..|.|||:||..|| .|||.|:..|..|.
Zfish   172 YKDK--FTQNMLCAGFMEGGKGVCHGDSGGPLV-CNGELRGVVSWGAGCAEPGYPAVYVEVCRYS 233

  Fly   259 DWI 261
            |||
Zfish   234 DWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 80/225 (36%)
Tryp_SPc 42..263 CDD:238113 82/226 (36%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 82/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.