DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG42694

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:217 Identity:56/217 - (25%)
Similarity:98/217 - (45%) Gaps:27/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GEHV-CGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHND 127
            |.|| |.||:|:.|::|:||.|::...: |.:..|..:.|:....|.|....|. ||.......|
  Fly    53 GTHVLCSGSLISKQFVLSAAQCIDVHGK-LFVQLGVSNATKSPHWYTVSNVVIP-SHSGKRLQRD 115

  Fly   128 IALIHTAKPIVYDDLTQPIKLASKGS---LPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDH 189
            |.|:..::.:.|:|...||.:|...:   :.|:....|.:.|.|.      :...|.|.|:.:..
  Fly   116 IGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSK------NKNPQTIVLSQLSR 174

  Fly   190 DNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGG----PLVDAN----QTLVGV---VNWGEAC 243
            |.|:..: :.| ::...:|..:.:...||..|||.    |::..:    :.|.|:   ||....|
  Fly   175 DRCKLNL-SGN-VTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWC 237

  Fly   244 AIGYPDVFGSVAYYHDWIEQMM 265
            :  .|.::..||....|||.::
  Fly   238 S--EPAIYIDVAECVGWIETVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 53/211 (25%)
Tryp_SPc 42..263 CDD:238113 55/213 (26%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 56/214 (26%)
Tryp_SPc 46..253 CDD:214473 53/211 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.