DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Klk9

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:287 Identity:85/287 - (29%)
Similarity:124/287 - (43%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVC 68
            |||.|:|.                      ||...:||.:|..:......|:|..:. .....:|
Mouse     7 LVLFSLLA----------------------GHCGADTRAVGARECVRNSQPWQAGLF-YLTRQLC 48

  Fly    69 GGSIIAPQWILTAAHC----------------MEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHC 117
            |.::|..||:||||||                .|.|.|.|.:   |..:..||  :..|.|    
Mouse    49 GATLINDQWLLTAAHCRKPYLWVRLGEHHLWRWEGPEQLLLV---TDFFPHPG--FNPDLS---- 104

  Fly   118 SHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWG-RYSTQLQK 181
            ::|   :::||.||...:.:......||:.|..  |.|.||.:..::||||..:.. :|...||.
Mouse   105 AND---HNDDIMLIRLPRKVRLTPAVQPLNLTE--SRPPVGTQCLISGWGSVSSSKLQYPMTLQC 164

  Fly   182 IDLNYIDHDNCQSRVRNANWLSEGHV-----CTFTQE-GEGSCHGDSGGPLVDANQTLVGVVNWG 240
            .:::.:|:..|:       |...||:     |....| |.|||.|||||||| ...||.|:|:.|
Mouse   165 ANISILDNKLCR-------WAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLV-CEGTLAGIVSGG 221

  Fly   241 -EACA-IGYPDVFGSVAYYHDWIEQMM 265
             |.|: ...|.|:.:|..|.:|||..|
Mouse   222 SEPCSRPRRPAVYTNVFDYLEWIESTM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/244 (30%)
Tryp_SPc 42..263 CDD:238113 74/245 (30%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.