DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and LOC100498532

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:233 Identity:80/233 - (34%)
Similarity:126/233 - (54%) Gaps:14/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDY-T 102
            :.:::||.:......|:|| :....|.:.||||:|:|:||::||||.: |.:.|..:.|..|. .
 Frog    22 DDKIVGGYECTPHSQPWQV-LFTYNGGNWCGGSLISPRWIISAAHCYQ-PPKTLVALLGEHDLKK 84

  Fly   103 RPGAE--YLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTG 165
            :.|.|  ..|:.:..|..:...|:.:||.|:..|||..|:...|||.:|.  |.|..|.|..::|
 Frog    85 KEGTEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYNQYVQPIPVAR--SCPTDGAKCLVSG 147

  Fly   166 WGSTKTWG-RYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEGEGSCHGDSGGPLVD 228
            :|:...:. ||..|||.:::..:...:|::..  ...:||...|. |.:.|:|||||||||||: 
 Frog   148 FGNVLGYNVRYPDQLQCLEVPIVSDSSCKASY--PRMISENMFCAGFLEGGKGSCHGDSGGPLI- 209

  Fly   229 ANQTLVGVVNWGEACAI--GYPDVFGSVAYYHDWIEQM 264
            .|..|.|.|:||.:..|  ..|.|:..|..|.|||:.:
 Frog   210 CNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIKNI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/226 (35%)
Tryp_SPc 42..263 CDD:238113 80/227 (35%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 80/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.