DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and LOC100498083

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_012810073.2 Gene:LOC100498083 / 100498083 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:232 Identity:72/232 - (31%)
Similarity:112/232 - (48%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTR 103
            :.::|||........||.||:  ..|.|.||||:|..||:::||||.:..:| :::....:..:.
 Frog    18 DDKIIGGATCAKNSVPYIVSL--NAGYHFCGGSLINNQWVVSAAHCYQASVQ-VRLGEHNIAVSE 79

  Fly   104 PGAEYLVDGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGW 166
             |.|..::.:|:  |..::.....|||.||..:.....:.....:.|.|  |....|....::||
 Frog    80 -GTEQFINSAKVIRHSGYNSRTLDNDIMLIKLSSAASLNSAVNAVALPS--SCAAAGTSCLISGW 141

  Fly   167 GSTKTWG-RYSTQLQKIDLNYIDHDNCQ----SRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPL 226
            |:|...| .|...||.::...:....|.    .::.| |....|    |.:.|:.||.||||||:
 Frog   142 GNTSASGSNYPNLLQCLNAPILTTAQCSGAYPGQITN-NMFCAG----FLEGGKDSCQGDSGGPV 201

  Fly   227 VDANQTLVGVVNWGEACA-IGYPDVFGSVAYYHDWIE 262
            | .|..|.|:|:||..|| ..||.|:..|..|:.||:
 Frog   202 V-CNGQLQGIVSWGIGCAQRNYPGVYTKVCNYNSWIQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 70/227 (31%)
Tryp_SPc 42..263 CDD:238113 72/229 (31%)
LOC100498083XP_012810073.2 Tryp_SPc 21..239 CDD:238113 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.