DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Cfi

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_077071.1 Gene:Cfi / 79126 RGDID:620429 Length:604 Species:Rattus norvegicus


Alignment Length:302 Identity:86/302 - (28%)
Similarity:119/302 - (39%) Gaps:77/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GPTEAMRMRGEPLPGLANIERHRSTEAVP-------------QGRVIGGTTAAEGNWPWIASIQN 71
            |.||......|.|....:.||.|....:|             :.||:||..|..|::||..:|::
  Rat   317 GETEIETEETEMLTPDMDTERKRIKSLLPKLSCGVKRNTHIRRKRVVGGKPAEMGDYPWQVAIKD 381

  Fly    72 AYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW--DLYAPYYTVSQIHVHCNFDKP 134
            . ....||.|.:...|:||||.||...|..|..|.|..:||.  :.......||::.||..::..
  Rat   382 G-DRITCGGIYIGGCWILTAAHCVRPSRYRNYQVWTSLLDWLKPNSQLAVQGVSRVVVHEKYNGA 445

  Fly   135 LYHNDIALLQLS---SKIE---FNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEA 193
            .|.|||||:::.   .|.|   .|.|...:..:.. ..:..|:...:|||               
  Rat   446 TYQNDIALVEMKKHPGKKECELINSVPACVPWSPY-LFQPNDRCIISGWG--------------- 494

  Fly   194 SGTYLPVDACREKLQNQ-------DDVDLGHVCVQM----------------DAGQGACHGDTGG 235
                      ||| .||       .:|||...|.:.                |....||.||:||
  Rat   495 ----------REK-DNQKVYSLRWGEVDLIGNCSRFYPGRYYEKEMQCAGTSDGSIDACKGDSGG 548

  Fly   236 PLIDEQQRLV----GIGNWGVPCGR-GYPDVYARTAFYHDWI 272
            ||:.:....|    ||.:||..||: .:|.||.|.|.|.|||
  Rat   549 PLVCKDVNNVTYVWGIVSWGENCGKPEFPGVYTRVASYFDWI 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 75/256 (29%)
Tryp_SPc 52..275 CDD:238113 76/257 (30%)
CfiNP_077071.1 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 228..258 CDD:197566
LDLa 264..298 CDD:294076
Tryp_SPc 361..590 CDD:214473 75/256 (29%)
Tryp_SPc 362..591 CDD:238113 76/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.