DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and zgc:153968

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:244 Identity:83/244 - (34%)
Similarity:117/244 - (47%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYH-------LCGAIILDETWVLTAASCVAGLRPLNLLVVTG 108
            |:|||.||..|:|||..||      |       |||..:::..|||:||.|...|...||:|..|
Zfish    35 RIIGGQTAMAGSWPWQVSI------HYIPTGGLLCGGTLINREWVLSAAQCFQKLTASNLVVHLG 93

  Fly   109 TVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITL-ADIDELEEGDKL 172
            .:...|....:...|||..|..:|.....||||||:||:.:.|.|..|.:.| |....|.:|...
Zfish    94 HLSTGDPNVIHNPASQIINHPKYDSATNKNDIALLKLSTPVSFTDYIKPVCLTASGSSLGKGAVS 158

  Fly   173 TFAGWGSSEAMGT-YGRYLQEASGTYLPVDA---CREKLQNQDDVDLGHVCV-QMDAGQGACHGD 232
            ...||||....|| :...|||..   :||.:   |:....:.  :..|.:|. ..:.|:|.|.||
Zfish   159 WITGWGSINTGGTQFPTTLQEVK---IPVVSNGDCKSAYGSL--ITDGMICAGPNEGGKGICMGD 218

  Fly   233 TGGPLI---DEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRTTMN 277
            .||||:   .||....||.::|..|.: ..|.|:.|.:.|..||::.::
Zfish   219 GGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSEYESWIKSQIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 81/237 (34%)
Tryp_SPc 52..275 CDD:238113 82/239 (34%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 81/237 (34%)
Tryp_SPc 36..265 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.