DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Prss54

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:229 Identity:61/229 - (26%)
Similarity:93/229 - (40%) Gaps:37/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 WPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHV 127
            :||:.|||:....||....||.|.|:|:.||.:...:.:..:|....:|........|:|:.|..
Mouse    89 FPWVVSIQDKQYTHLAFGCILSEFWILSTASALQHRKEVIAVVGISNMDPRKTDHREYSVNTIIP 153

  Fly   128 HCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKL---------TFAGWGSSEAM 183
            |.|||.....|:||||:..|.:.|||:.:.|...       |.||         ..|||..:.|.
Mouse   154 HENFDNVSMGNNIALLKTESAMHFNDLVQAICFL-------GKKLHKPPALKNCWVAGWNPTSAT 211

  Fly   184 GTY--GRYLQEASGTYLPVDACREKLQNQDDVDLGHVCV-QMDAGQGACHGDTGGPLIDEQQR-- 243
            |.:  ...|:..|...:.|...|...:.:        |. ........|.|:.|.|::.:.::  
Mouse   212 GNHMTMSILRRISVKDIEVCPLRRHQKTE--------CASHTKEPNNVCLGEPGSPMMCQAKKLD 268

  Fly   244 ---LVGIGNWGVPCGRGYPD--VYARTAFYHDWI 272
               |.|:..:|   |...|.  :|...|.|.|||
Mouse   269 LWILRGLLAYG---GDSCPGLFLYTSVADYSDWI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 59/227 (26%)
Tryp_SPc 52..275 CDD:238113 61/229 (27%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.