DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Klk10

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:295 Identity:76/295 - (25%)
Similarity:120/295 - (40%) Gaps:63/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WNLTVLLGLTLLALQ-GPTEAMRMRGEPLPGLANIERHRSTEAVPQGRV---IGGTTAAEGNWPW 65
            |:|..|| |.||.:| ...:|:.     |||.|.             ||   ..|........||
Mouse    15 WSLVKLL-LPLLMVQLWAAQALL-----LPGNAT-------------RVDLEASGAQCERDYHPW 60

  Fly    66 IASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCN 130
            ..|:.:...:. |..:::|:.||||||.|... :||...|       .|.:...:...|:.   :
Mouse    61 QVSLFHNLQFQ-CAGVLVDQNWVLTAAHCWRN-KPLRARV-------GDDHLLLFQKEQLR---S 113

  Fly   131 FDKPLYH-----------------NDIALLQLSSKIEFNDVTKNITLADIDE--LEEGDKLTFAG 176
            ...|::|                 :|:.:|:|||.:.   :|.|:....:..  .:.|.:...:|
Mouse   114 TSSPVFHPKYQACSGPILPHRSDEHDLMMLKLSSPVM---LTSNVHPVQLPFRCSQPGQECQVSG 175

  Fly   177 WGSSEAMGT-YGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDE 240
            ||:|.:... |.|.|..:..|.|....|.......  :....:|.:.|..|.:|..|:||||:.:
Mouse   176 WGTSASRRVKYNRSLSCSKVTLLSQKQCETFYPGV--ITNSMICAEADGNQDSCQSDSGGPLVCD 238

  Fly   241 QQRLVGIGNWGV-PCGRG-YPDVYARTAFYHDWIR 273
             ..|.|:.:||: |||.. :|.||:....|..|||
Mouse   239 -DTLHGVLSWGIYPCGAAQHPSVYSEICKYTPWIR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 60/245 (24%)
Tryp_SPc 52..275 CDD:238113 62/247 (25%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.