DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Klk12

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:257 Identity:68/257 - (26%)
Similarity:108/257 - (42%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASC---- 94
            ||:..:|.         ::..|....:.:.||...:.:. .|..||.:::|..||||||.|    
Mouse    13 GLSQADRE---------KIYNGVECVKNSQPWQVGLFHG-KYLRCGGVLVDRKWVLTAAHCRDKY 67

  Fly    95 VAGLRPLNLLVVTGTVDWWD---------LYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIE 150
            |..|...:|.    .:||.:         .:..|....|.|.|          |:.||:|:..|.
Mouse    68 VVRLGEHSLT----KLDWTEQLRHTTFSITHPSYQGAYQNHEH----------DLRLLRLNRPIH 118

  Fly   151 FNDVTKNITLADIDELEEGDKLTFAGWG-SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVD 214
            .....:.:.|.. ..:..|.....:||| :::....:...||..:.:.:..:.||.....:  |.
Mouse   119 LTRAVRPVALPS-SCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGR--VT 180

  Fly   215 LGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGV--PCG-RGYPDVYARTAFYHDWIR 273
            ...:|...:||:.||.||:||||:.... |.|:.:||.  ||| :|.|.||.:...|.||||
Mouse   181 ENMLCAGGEAGKDACQGDSGGPLVCGGV-LQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/237 (26%)
Tryp_SPc 52..275 CDD:238113 65/239 (27%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.