DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and prss1

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:244 Identity:70/244 - (28%)
Similarity:108/244 - (44%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AVPQG----RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAG-----LRPL 101
            |.|.|    :::||....:...|:..|:.:  .||.||..::...||::||.|...     |...
Zfish    15 AAPLGDDDDKIVGGYECTKNGVPYQVSLNS--GYHFCGGSLISNLWVVSAAHCYKSRVQVRLGEH 77

  Fly   102 NLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDEL 166
            |:.|..||       ..:....::..|.:::.....||:.|::|||..:.|...|.::|.. ...
Zfish    78 NIDVTEGT-------EQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPS-SCA 134

  Fly   167 EEGDKLTFAGWGSSEAMGT-YGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQ-MDAGQGAC 229
            ..|.....:|||:..|.|: |...|...:...|....||.....|  :.....|.. |:.|:.:|
Zfish   135 SSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPGQ--ISSNMFCAGFMEGGKDSC 197

  Fly   230 HGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTMN 277
            .||:|||::...| |.||.:||..|. |..|.|||:...:..|||.|||
Zfish   198 QGDSGGPVVCNNQ-LQGIVSWGYGCAQRNKPGVYAKVCNFTTWIRNTMN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 61/228 (27%)
Tryp_SPc 52..275 CDD:238113 64/230 (28%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 61/228 (27%)
Tryp_SPc 25..243 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.