DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:242 Identity:76/242 - (31%)
Similarity:116/242 - (47%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQN-AYSYHLCGAIILDETWVLTAASCVAG-----LRPLNLLVVTGT 109
            :::||..|..|:|||..|:|: .|..|.||..::::.|||:||.|...     :..|.|...:|:
Zfish    35 KIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSIGTIMVKLGLQSQSGS 99

  Fly   110 VDWWDLYAPYY---TVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDK 171
                   .||.   ||.|:..|.|::.|...|||||::|.|.:.|||..:.:.||..........
Zfish   100 -------NPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGT 157

  Fly   172 LTF-AGWGS-SEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQM--DAGQGACHGD 232
            |:: .|||. |.|.......|||.....:....|:.....  ::....:|..:  ..|:.:|.||
Zfish   158 LSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPG--EITSNMICAGLLDQGGKDSCQGD 220

  Fly   233 TGGPLID---EQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRTT 275
            :|||::.   .|....||.::|..|.. |||.||||.:.|.|||.::
Zfish   221 SGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 74/237 (31%)
Tryp_SPc 52..275 CDD:238113 76/239 (32%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 74/237 (31%)
Tryp_SPc 36..264 CDD:238113 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.