DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and zgc:123217

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:259 Identity:74/259 - (28%)
Similarity:119/259 - (45%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDL 115
            |::|||.|..|:|||..|| :..:.|:||..::...||:|||.|          ::...::.|.|
Zfish    36 RIVGGTDAPAGSWPWQVSI-HYNNRHICGGTLIHSQWVMTAAHC----------IINTNINVWTL 89

  Fly   116 YAPYYT--------------VSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDEL 166
            |....|              :..|..|.:|:..|.:|||:|::||..:.|:...:.|.||..:.:
Zfish    90 YLGRQTQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANNSI 154

  Fly   167 -EEGDKLTFAGWGS---SEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQM----D 223
             ..|......|||:   .:|:.. .:.||:..   :||.|........:.|:...:..||    .
Zfish   155 FYNGTSCWATGWGNIGKDQALPA-PQTLQQVQ---IPVVANSLCSTEYESVNNATITPQMICAGK 215

  Fly   224 AGQGACHGDTGGPLIDEQQRL---VGIGNWGVPCG---RGYPDVYARTAFYHDWIRTTMNGCTI 281
            |.:|.|.||:|||...:|..:   .||.::|...|   ..|||||:|.:.:..||:..:.|..|
Zfish   216 ANKGTCQGDSGGPFQCKQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNVQGSAI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/248 (28%)
Tryp_SPc 52..275 CDD:238113 71/250 (28%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 70/248 (28%)
Tryp_SPc 37..273 CDD:238113 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.