DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG17239

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:231 Identity:75/231 - (32%)
Similarity:107/231 - (46%) Gaps:10/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVT 107
            |:..:|: |::||......:.||.|||.....:| |||.|..|..|:|||.|:.. |....|.|.
  Fly    16 SSNWIPE-RIVGGDLITILSVPWQASILRLGRFH-CGAAIYSEDIVITAAHCLTD-RETEFLSVR 77

  Fly   108 GTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKL 172
            ....:.........||.:.:|..:|:. :.||||:::|.||:........|.|||... ..|...
  Fly    78 VGSSFTFFGGQVVRVSSVLLHEEYDQS-WSNDIAVMRLQSKLRLGSAVSVIPLADTPP-ASGSPA 140

  Fly   173 TFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPL 237
            |.:|||:......|...:..||...:..|.||.....:...|:  :|... .|:.||.||:||||
  Fly   141 TVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDM--ICAAA-PGKDACSGDSGGPL 202

  Fly   238 IDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWI 272
            : ...:||||.::|..|.. .||.|||..|....||
  Fly   203 V-SGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 71/221 (32%)
Tryp_SPc 52..275 CDD:238113 72/222 (32%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 71/221 (32%)
Tryp_SPc 24..237 CDD:238113 70/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.