DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG34458

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:110/241 - (45%) Gaps:9/241 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLV 105
            |...:...:.|:|||..||.|.:|...|:|....:| ||..::.:|.::|||.|..|..|..:..
  Fly    21 HSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHH-CGGSLISDTMIVTAAHCTMGQNPGQMKA 84

  Fly   106 VTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD 170
            :.||.|........:.::|..:|..::......|::|::|||.:......:.|.|||.|.....|
  Fly    85 IVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAAD 149

  Fly   171 KLT-FAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ-GACHGDT 233
            .:. .:|:|:..........|:.|.......|.|..  ||...:....||....:|| .:|.||:
  Fly   150 TMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNS--QNIPGLTDRMVCAGHPSGQVSSCQGDS 212

  Fly   234 GGPL-IDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTMN 277
            |||| :|  .:|.|:.:||..|| :|.|.:|........||:...|
  Fly   213 GGPLTVD--GKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/224 (29%)
Tryp_SPc 52..275 CDD:238113 66/226 (29%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 65/224 (29%)
Tryp_SPc 32..254 CDD:238113 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.