DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Klk4

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:240 Identity:65/240 - (27%)
Similarity:110/240 - (45%) Gaps:36/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASC-----VAGLRPLNLLVVTGTV 110
            |:|.|...:..:.||.|::.:...: .|..:::...|||:||.|     :.||...||   .|:.
Mouse    31 RIIQGQDCSPHSQPWQAALFSEDGF-FCSGVLVHPQWVLSAAHCLQESYIVGLGLHNL---KGSQ 91

  Fly   111 DWWDLYAPYYTVSQIHV---HCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKL 172
            :      |...:.:.|:   |.||:.|.:.||:.|::|:..:..::..::|.:| ......||..
Mouse    92 E------PGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVA-TQCPTPGDTC 149

  Fly   173 TFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQG-----ACHGD 232
            ..:|||..: .|.....||..:.:....:.||  |.......|...|    ||.|     :|:||
Mouse   150 LVSGWGQLK-NGKLPSLLQCVNLSVASEETCR--LLYDPVYHLSMFC----AGGGQDQKDSCNGD 207

  Fly   233 TGGPLIDEQ--QRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRT 274
            :|||::..:  |.||.:|..  .||: |.|.||.....:.:||:|
Mouse   208 SGGPIVCNRSLQGLVSMGQG--KCGQPGIPSVYTNLCKFTNWIQT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/236 (26%)
Tryp_SPc 52..275 CDD:238113 64/239 (27%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.