DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and PRTN3

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:264 Identity:77/264 - (29%)
Similarity:127/264 - (48%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PLPGLANI-------ERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQ---NAYSYHLCGAIILDE 85
            |.|.||::       ...|:.|      ::||..|...:.|::||:|   |..| |.||..::..
Human     6 PSPALASVLLALLLSGAARAAE------IVGGHEAQPHSRPYMASLQMRGNPGS-HFCGGTLIHP 63

  Fly    86 TWVLTAASCVAGL--RPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSK 148
            ::|||||.|:..:  |.:|:::....|...:....:::|:|:.:: |:|.....||:.|:||||.
Human    64 SFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLN-NYDAENKLNDVLLIQLSSP 127

  Fly   149 IEFNDVTKNITLADIDE-LEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDD 212
            ...:.....:.|...|: :..|.:....|||...|.....:.|||.:.|.:.. .||..      
Human   128 ANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF-FCRPH------ 185

  Fly   213 VDLGHVCVQMDAGQ-GACHGDTGGPLIDEQQRLVGIGN---WGVPCG-RGYPDVYARTAFYHDWI 272
                ::|..:...: |.|.||:|||||.: ..:.||.:   ||  |. |.:||.:.|.|.|.|||
Human   186 ----NICTFVPRRKAGICFGDSGGPLICD-GIIQGIDSFVIWG--CATRLFPDFFTRVALYVDWI 243

  Fly   273 RTTM 276
            |:|:
Human   244 RSTL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 67/231 (29%)
Tryp_SPc 52..275 CDD:238113 70/233 (30%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.