DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:183 Identity:49/183 - (26%)
Similarity:74/183 - (40%) Gaps:57/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PLYHN-----DIALLQLSSKIEFNDVTKNITLADIDE----LEEGDKLTFAGWGSSEAMGTYGRY 189
            |||:.     ||.|::||:.||.|   :.::||.:.:    |..|.....:||||:...|  |..
Zfish    32 PLYNRSTNNADIMLIKLSAPIELN---RYVSLAPLPKQNTGLLAGRMCRVSGWGSTSHSG--GLI 91

  Fly   190 LQEASGTYLPV------------------------------DACREKLQNQDDVDLGHVCVQMDA 224
            ........||:                              |||:...|.     |.|:.|.:  
Zfish    92 PLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDACKNSTQY-----LCHLIVYL-- 149

  Fly   225 GQGACHGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
                |.||:||||:.: .|:.|:.:||..|| ..:|.||...:.:..||..|:
Zfish   150 ----CQGDSGGPLVCD-GRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWIDQTI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 46/177 (26%)
Tryp_SPc 52..275 CDD:238113 48/180 (27%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 48/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.