DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and KLK7

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:283 Identity:75/283 - (26%)
Similarity:127/283 - (44%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNA 72
            ::||.|.:|.|   :.|:...||...|               .::|.|...|.|:.||..::.:.
Human     4 SLLLPLQILLL---SLALETAGEEAQG---------------DKIIDGAPCARGSHPWQVALLSG 50

  Fly    73 YSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYH 137
            ...| ||.::::|.||||||.|......::|    |:....|..|.....|:...|..:....:.
Human    51 NQLH-CGGVLVNERWVLTAAHCKMNEYTVHL----GSDTLGDRRAQRIKASKSFRHPGYSTQTHV 110

  Fly   138 NDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGS---------SEAMGTYGRYL--Q 191
            ||:.|::|:|:...:.:.|.:.|....| ..|...|.:|||:         |:.|....:.:  |
Human   111 NDLMLVKLNSQARLSSMVKKVRLPSRCE-PPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQ 174

  Fly   192 EASGTYLPVDACREKLQNQDDVDLGHVCVQM-DAGQGACHGDTGGPLIDEQQRLVGIGNWGV-PC 254
            :.:..|      ::.|:|      ..:|..: |:.:.||:||:||||:. :..|.|:.:||. ||
Human   175 DCTKVY------KDLLEN------SMLCAGIPDSKKNACNGDSGGPLVC-RGTLQGLVSWGTFPC 226

  Fly   255 GR-GYPDVYARTAFYHDWIRTTM 276
            |: ..|.||.:...:..||..||
Human   227 GQPNDPGVYTQVCKFTKWINDTM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/234 (26%)
Tryp_SPc 52..275 CDD:238113 64/236 (27%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.