DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and KLK15

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:252 Identity:71/252 - (28%)
Similarity:106/252 - (42%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVT 107
            ||.|....:::.|...|..:.||..::.....:: |||.::...|||:||.|.:....:.|    
Human    13 STAAQDGDKLLEGDECAPHSQPWQVALYERGRFN-CGASLISPHWVLSAAHCQSRFMRVRL---- 72

  Fly   108 GTVDWWDLYAP--YYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD 170
            |..:......|  ..|.|::..|..::...:.|||.||:|......|...:...|..... ..|:
Human    73 GEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCP-HPGE 136

  Fly   171 KLTFAGWG--SSEAMGTYGRYLQEASGTYLP--VDACREKLQNQDDVDLGH--------VCVQMD 223
            ....:|||  |....||.|....:.|   ||  :......:.:....|..:        ||...:
Human   137 ACVVSGWGLVSHNEPGTAGSPRSQVS---LPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAE 198

  Fly   224 AGQGA--CHGDTGGPLIDEQQRLVGIGNWG-VPC-GRGYPDVYARTAFYHDWIRTTM 276
             |:||  |.||:||||:. ...|.||.:|| ||| ....|.||.:...|.:|||.||
Human   199 -GRGAESCEGDSGGPLVC-GGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 63/238 (26%)
Tryp_SPc 52..275 CDD:238113 66/240 (28%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.