DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and C1RL

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_057630.2 Gene:C1RL / 51279 HGNCID:21265 Length:487 Species:Homo sapiens


Alignment Length:287 Identity:78/287 - (27%)
Similarity:121/287 - (42%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYH-LCGAIILDET 86
            :.|.:.|.|:..:|   ::::|        :|.:.|..||:||    |...|.| ..|..:|.:.
Human   227 QCMPVCGRPVTPIA---QNQTT--------LGSSRAKLGNFPW----QAFTSIHGRGGGALLGDR 276

  Fly    87 WVLTAASCV-----AGLR---PLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHN---DI 140
            |:||||..:     ..||   .:|:.:....:|.. |....:.|.::.||.::.:...||   ||
Human   277 WILTAAHTIYPKDSVSLRKNQSVNVFLGHTAIDEM-LKLGNHPVHRVVVHPDYRQNESHNFSGDI 340

  Fly   141 ALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFA-------GWGSSEAMGTYGRYLQEASGTYL 198
            |||:|...|........:.|.|.:.|.....|.:.       ||.::|.  .|.|         |
Human   341 ALLELQHSIPLGPNVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTEL--KYSR---------L 394

  Fly   199 PV---DACREKLQNQDDVDL---GHVCVQMDAGQ-GACHGDTGGPLI--DEQQR---LVGIGNWG 251
            ||   :||...||.:...::   ...||..:..: ..|.||:|...:  |....   ..||.:||
Human   395 PVAPREACNAWLQKRQRPEVFSDNMFCVGDETQRHSVCQGDSGSVYVVWDNHAHHWVATGIVSWG 459

  Fly   252 VPCGRGYPDVYARTAFYHDWIRTTMNG 278
            :.||.|| |.|.:...|.|||:..|||
Human   460 IGCGEGY-DFYTKVLSYVDWIKGVMNG 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 68/251 (27%)
Tryp_SPc 52..275 CDD:238113 70/253 (28%)
C1RLNP_057630.2 CUB 40..162 CDD:238001
Tryp_SPc 247..480 CDD:238113 69/249 (28%)
Tryp_SPc 247..479 CDD:214473 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.