DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and XB5758585

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001011293.1 Gene:XB5758585 / 496746 XenbaseID:XB-GENE-5758586 Length:248 Species:Xenopus tropicalis


Alignment Length:248 Identity:67/248 - (27%)
Similarity:101/248 - (40%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAY-SYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWD 114
            ::||....|..:..|  .:...| .|..||..::...|:::||||  ...|..|:...|.   .|
 Frog    21 KIIGEYECAPHSQKW--QVYFTYKGYPWCGGSLISSRWIISAASC--NQSPKYLIAHLGK---HD 78

  Fly   115 LYAPYYTVSQIHVHCNFDKPLY-----HNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTF 174
            :.....|...|.|...|....|     .|:|.|::|:...:||...:.|.:|.... .||.....
 Frog    79 ITREEGTEQHIQVEKTFPHNRYLGLSDSNNIMLVKLAEPAQFNQFVQPIKVASSCP-REGKVCQV 142

  Fly   175 AGWGSSEAMG-TYGRYLQEASGTYLPVDAC-----REKLQN--------QDDVDLGHVCVQMDAG 225
            :|:|:..:.. .|...||......||..:|     .:|:..        |||.|           
 Frog   143 SGFGNLNSYAEKYPDRLQCLDLPILPESSCDAYFSPKKMHTNLMCAGFAQDDKD----------- 196

  Fly   226 QGACHGDTGGPLIDEQQRLVGIGNWGVPC-GRGYPDVYARTAFYHDWIRTTMN 277
              :|.||.|||||.:.: |.||..||..| |||.|.||.:...:.:|::..:|
 Frog   197 --SCQGDAGGPLICKGE-LYGIILWGNECSGRGIPGVYLKVCNFTNWMQNIIN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/241 (27%)
Tryp_SPc 52..275 CDD:238113 66/243 (27%)
XB5758585NP_001011293.1 Tryp_SPc 21..240 CDD:214473 65/240 (27%)
Tryp_SPc 22..244 CDD:238113 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.