DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and prss1.2

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001011251.1 Gene:prss1.2 / 496697 XenbaseID:XB-GENE-6083469 Length:249 Species:Xenopus tropicalis


Alignment Length:235 Identity:58/235 - (24%)
Similarity:107/235 - (45%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPW-IASIQNAYSYHLCGAIILDETWVLTAASC-------VAGLRPLNLLVVT 107
            :::||......:.|| :...||:..:  ||..::...|:::||.|       ||.|...:|....
 Frog    22 KIVGGYECTPHSQPWQVYFTQNSQVF--CGGSLVTPRWIISAAHCYRPPKTLVAHLGDHDLTKEE 84

  Fly   108 GTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKL 172
            ||       ..:..|...:.|.::....|.:||.|::|:...::|...:.|.:|.... .||.:.
 Frog    85 GT-------EQHIQVEAAYKHSSYKDEAYDHDIMLVKLAKPAQYNQYVQPIPVARSCP-REGTEC 141

  Fly   173 TFAGWGS--SEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQ-MDAGQGACHGDTG 234
            ..:|:|:  |:.:|.:...||......|...:|:...:.....::  .|.. ::.|:.:|..|:|
 Frog   142 LVSGYGNLRSDHIGEFPDRLQCVDVPVLSDSSCKASCRGLFTENM--FCAGFLEGGKDSCQVDSG 204

  Fly   235 GPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIR 273
            |||:...: |.|:.:||..|. |..|.|||:...|..|::
 Frog   205 GPLVCNGE-LYGVVSWGWGCAQRNAPGVYAKVCNYLRWVQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 57/232 (25%)
Tryp_SPc 52..275 CDD:238113 58/234 (25%)
prss1.2NP_001011251.1 Tryp_SPc 23..245 CDD:238113 58/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.