DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and epsilonTry

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:278 Identity:83/278 - (29%)
Similarity:125/278 - (44%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLLGLTLLALQGPTEAMRMRGEPLP-GLANIERHRSTEAVPQ--GRVIGGTTAAEGNWPWIASIQ 70
            |||.:...||.|          .:| ||           :||  ||::||...:....|:..|:|
  Fly     6 VLLSVLACALAG----------TIPDGL-----------LPQLDGRIVGGYETSIDAHPYQVSLQ 49

  Fly    71 NAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPL 135
            . |..|.||..|.....|:|||.|:..:...:|.:..|:. :|......::|.....|..::...
  Fly    50 R-YGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGST-YWRSGGSVHSVRSFRNHEGYNSRT 112

  Fly   136 YHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMG-TYGRYLQEASGTYLP 199
            ..||||::::.|.:.|....:.|.:||.:. .||.....:|||::|:.| |...:|.......:.
  Fly   113 MVNDIAIIRIESDLSFRSSIREIRIADSNP-REGATAVVSGWGTTESGGSTIPDHLLAVDLEIID 176

  Fly   200 VDACREKLQNQDDVDLGH------VCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGR-G 257
            |..||     .|:...|.      :|... ..:.||.||:||||: ...||||:.:||..||. .
  Fly   177 VSRCR-----SDEFGYGKKIKDTMLCAYA-PHKDACQGDSGGPLV-SGDRLVGVVSWGYGCGDVR 234

  Fly   258 YPDVYARTAFYHDWIRTT 275
            ||.|||..|.:|:||..|
  Fly   235 YPGVYADVAHFHEWIERT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 68/228 (30%)
Tryp_SPc 52..275 CDD:238113 69/230 (30%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 68/228 (30%)
Tryp_SPc 31..252 CDD:238113 69/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.