DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and KLK14

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:271 Identity:78/271 - (28%)
Similarity:112/271 - (41%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIAS-IQNAYSYH 76
            |.|.|||....||....|                 .:.::|||.|....:.||.|: :.......
Human     3 LLLTALQVLAIAMTQSQE-----------------DENKIIGGHTCTRSSQPWQAALLAGPRRRF 50

  Fly    77 LCGAIILDETWVLTAASCVAGLRPLNLLVVTG--TVDWWDLYAPYYTVSQIHVHCNFDKPLYHND 139
            |||..:|...||:|||.|.   ||: |.|..|  .:..|:.......|.:...|.|::...:.||
Human    51 LCGGALLSGQWVITAAHCG---RPI-LQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDND 111

  Fly   140 IALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGS-SEAMGTYGRYLQEASGTYLPVDAC 203
            :.||||..........:.|.:.... ...|.....:|||: |..:..|...||..:....|.:.|
Human   112 LMLLQLQQPARIGRAVRPIEVTQAC-ASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVC 175

  Fly   204 REKLQNQDDVDLGHVCVQM-DAGQGACHGDTGGPLIDEQQRLVGIGNWGVP-CG-RGYPDVYART 265
            ::....  .:..|.||..: ..|:.:|.||:||||:...| |.|:.:||:. |. .|||.||...
Human   176 QKAYPR--TITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQ-LQGLVSWGMERCALPGYPGVYTNL 237

  Fly   266 AFYHDWIRTTM 276
            ..|..||..||
Human   238 CKYRSWIEETM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/227 (29%)
Tryp_SPc 52..275 CDD:238113 68/229 (30%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.