DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Gm5771

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:238 Identity:66/238 - (27%)
Similarity:111/238 - (46%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV-----AGLRPLNLLVV 106
            |...:::||.|..|.:.|:..|:.:  .||.||..::::.||::||.|.     ..|...|:.|:
Mouse    18 VDDDKIVGGYTCRENSVPYQVSLNS--GYHFCGGSLINDQWVVSAAHCYKTRIQVRLGEHNIKVL 80

  Fly   107 TGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDK 171
            .|.       ..:...::|..|.||::...:|||.|::|||.:..|.....:.|.. .....|.:
Mouse    81 EGN-------EQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPS-SCAPAGTQ 137

  Fly   172 LTFAGWGSSEAMG-TYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQ-MDAGQGACHGDTG 234
            ...:|||::.:.| :....||......||...|......:  :....||.. ::.|:.:|.||:|
Mouse   138 CLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGK--ITGNMVCAGFLEGGKDSCQGDSG 200

  Fly   235 GPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
            ||::...: |.||.:||..|. ...|.||.:...|.|||:.|:
Mouse   201 GPVVCNGE-LQGIVSWGYGCALADNPGVYTKVCNYVDWIQDTI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/228 (27%)
Tryp_SPc 52..275 CDD:238113 64/230 (28%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 62/228 (27%)
Tryp_SPc 23..241 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.