DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG11313

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:336 Identity:84/336 - (25%)
Similarity:133/336 - (39%) Gaps:85/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TLLALQGPTEA-MRMRGE---------PLPGLA-------NIERHRSTEAV------PQGRVIGG 55
            ::||...||:: ||...|         .||.:.       |..|.|..:.|      |...:.||
  Fly    45 SVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGG 109

  Fly    56 TTA----AEGN------WPWIASIQNAYSYH-------LCGAIILDETWVLTAASCVAG------ 97
            ..|    .:||      :.|:..::  |..|       .|...:::..:|:|||.||:.      
  Fly   110 DIAYNQITKGNETVLTEFAWMVLLE--YRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARK 172

  Fly    98 ----------LRPLNLLVVTGTVDWWDLYAP-YYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEF 151
                      |...|...|...::...|..| ...|.:|.:|.:|...|:.|||||::|:.::.:
  Fly   173 GDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAY 237

  Fly   152 NDVTKNITL---ADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASG--------TYLPVDACRE 205
            :...:.:.|   ..:...:.|...|.|||         ||.|...|.        ||:....||.
  Fly   238 SPSIRPVCLPSTVGLQNWQSGQAFTVAGW---------GRTLTSESSPVKMKLRVTYVEPGLCRR 293

  Fly   206 KLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQR---LVGIGNWGVPCG-RGYPDVYARTA 266
            |..:...:...|:|.:..:...:|.||:||||:...:.   |.||.::|:.|| |.:|.||....
  Fly   294 KYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVL 358

  Fly   267 FYHDWIRTTMN 277
            .|..||  |.|
  Fly   359 SYETWI--TQN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/269 (25%)
Tryp_SPc 52..275 CDD:238113 68/271 (25%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 9/32 (28%)
Tryp_SPc 116..367 CDD:238113 66/263 (25%)
Tryp_SPc 116..364 CDD:214473 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.