DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG9733

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:112/262 - (42%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QGRVIGGTTAAEGNWPWIASIQ------NAYSYHLCGAIILDETWVLTAASCVAGL--RPLNLLV 105
            :.|:..|.......:||:..::      |..| ..|...:::..:|||||.|:.|.  |.:..||
  Fly   159 RNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLS-TACAGSLINRRYVLTAAHCLTGRIEREVGTLV 222

  Fly   106 --------VTGTVDWWDLYAP-----------YYTVSQIHVHCNFDKPLYH--NDIALLQLSSKI 149
                    ....||     .|           .....:|.||..:.:...:  :||.|:::...:
  Fly   223 SVRLGEHDTRTAVD-----CPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNV 282

  Fly   150 EFNDVTKNITL---ADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKL-QNQ 210
            .::|..:.|.|   ..::..:.|.:.|.||||.:..|.. ....|:.:..|:....||::. |.:
  Fly   283 RYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMAR-SAVKQKVTVNYVDPAKCRQRFSQIK 346

  Fly   211 DDVDLGHVCVQMDAGQGACHGDTGGPLI---DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDW 271
            .:::...:|......:.:|.||:||||:   ||...|.||.::|..|| :.:|.||...|.|..|
  Fly   347 VNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIW 411

  Fly   272 IR 273
            ||
  Fly   412 IR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 62/257 (24%)
Tryp_SPc 52..275 CDD:238113 64/259 (25%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 62/257 (24%)
Tryp_SPc 162..415 CDD:238113 64/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.