DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG7829

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:245 Identity:78/245 - (31%)
Similarity:113/245 - (46%) Gaps:23/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVT 107
            |.|:.|..|::||..|...|.|:|.||| .|..|.||..|::...:|||..|:.|:....|.|..
  Fly    19 SLESRPDPRIVGGFPADIANIPYIVSIQ-LYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKV 82

  Fly   108 GTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLA--------DID 164
            |....:......::|:.:.||.||:......||.:::|         |||:||:        :.:
  Fly    83 GGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRL---------TKNLTLSRKVKAIPINPE 138

  Fly   165 ELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCV-QMDAGQGA 228
            .:.||...|.||||.....|.....|:.|....:...|||..|..  .|....:|. .:..|..|
  Fly   139 RVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGK--TVTDRMLCAGYLKGGTDA 201

  Fly   229 CHGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTMN 277
            |..|:|||| ..:::||||.:|||.|. ...|.||:|....|.|:...:|
  Fly   202 CQMDSGGPL-SVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 73/230 (32%)
Tryp_SPc 52..275 CDD:238113 73/232 (31%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 73/229 (32%)
Tryp_SPc 28..248 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.