DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG11836

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:240 Identity:77/240 - (32%)
Similarity:117/240 - (48%) Gaps:16/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVD---W 112
            |::||.......:||:|.|.....:| ||..:|.:.:||:||.||..||...:.|:.|..|   .
  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFH-CGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEIT 159

  Fly   113 WDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGW 177
            .:..|....|:.:..|.:||...|:||||||:|...|.|:.:.|.|.|...:....|...|..||
  Fly   160 SESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGW 224

  Fly   178 GSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCV---QMDAGQGACHGDTGGPLI- 238
            |.:...|.....:.:.....:.:..||.:......:....:|.   .||    :|.||:||||: 
  Fly   225 GRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMD----SCQGDSGGPLLL 285

  Fly   239 --DEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRTTM-NGC 279
              ..:..:|||.:|||.||| |||.||:|.:.:..||::.: |.|
  Fly   286 SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLENTC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 73/230 (32%)
Tryp_SPc 52..275 CDD:238113 74/232 (32%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.