DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG7142

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:291 Identity:81/291 - (27%)
Similarity:128/291 - (43%) Gaps:35/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GPTEAMRMRGEPLPGLANIERHRSTEAVPQ-----GRVIGGTTAAEGNWPWIASIQ----NAYSY 75
            |....|.|.   |.....:|...||...|:     .:.:....|...:.|::.|||    :....
  Fly    46 GAAHTMAMN---LAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLV 107

  Fly    76 HLCGAIILDETWVLTAASCVAGLRPL-NLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHN- 138
            |.|...|::|.|:||||.|::..:.: |.::|.|:.|..|.......:...|:.......||.. 
  Fly   108 HYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGG 172

  Fly   139 ----DIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWG--SSEAMGTYGRYLQEASGTY 197
                ||||:.....:.|:...:..||.:.|...||.. |..|||  |..|:..|...||||:...
  Fly   173 VNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYG-TLYGWGNVSMTAVPNYPHRLQEANMPI 236

  Fly   198 LPVDACREKLQNQDDVDL--GHVCV-QMDAGQGACHGDTGGPLID-------EQQRLV-GIGNWG 251
            |.::.| |::..:..:.|  .::|. .:..|...|..|:|||||.       ||..:| ||.:||
  Fly   237 LDMELC-EQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWG 300

  Fly   252 -VPCG-RGYPDVYARTAFYHDWIRTTMNGCT 280
             :||| :..|.|:.|.:.:.:||...::..|
  Fly   301 KMPCGQKNAPSVFVRVSAFTEWINQVISTAT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/245 (29%)
Tryp_SPc 52..275 CDD:238113 72/247 (29%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/243 (30%)
Tryp_SPc 84..323 CDD:214473 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.