DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG5255

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:230 Identity:95/230 - (41%)
Similarity:132/230 - (57%) Gaps:3/230 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QGRVIGGTTAAEGNWPWIASIQNAYS-YHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDW 112
            :.|::||..||.|..|:..|:|...| .|.||..|:||.|::|||.|..|.:.....|:|||.|.
  Fly    27 KNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDL 91

  Fly   113 WDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGW 177
            ....:.||...:|..|.|:....|.||||||.|:..|.|::.|:.:.| |.:.|..|.:|...||
  Fly    92 HQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVEL-DHEALVPGSRLLLTGW 155

  Fly   178 GSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQ 242
            |:....|.....||.....|:|.:.||....|...||:||||...|.|:||||||:||||: ...
  Fly   156 GTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNG 219

  Fly   243 RLVGIGNWGVPCGRGYPDVYARTAFYHDWIRTTMN 277
            :||.:.|||:||.:||||.:|..::|||:|||.::
  Fly   220 KLVALVNWGLPCAKGYPDAHASISYYHDFIRTHLS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 92/221 (42%)
Tryp_SPc 52..275 CDD:238113 93/223 (42%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 92/221 (42%)
Tryp_SPc 30..252 CDD:238113 93/223 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.