DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and ea

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:301 Identity:82/301 - (27%)
Similarity:125/301 - (41%) Gaps:80/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PLPG-----LANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSY----HLCGAIILDET 86
            ||||     |:|             |:.||.......:||:|.|:...|.    |.||..::...
  Fly   115 PLPGQCGNILSN-------------RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTR 166

  Fly    87 WVLTAASCVAGLRPLNLLVVTGTVDW---------WDLYA-PYYTV--------SQIHVHCNFDK 133
            :|:||:.||.| :.|       ..||         ||... |...|        :..|:....::
  Fly   167 YVITASHCVNG-KAL-------PTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVER 223

  Fly   134 PLYH-----------NDIALLQLSSKIEFNDVTKNITL-ADID---ELEEGDKLTFAGWGSSEAM 183
            .:.|           ||||||:|:.::|:.|..:.|.| .|::   ...:|..:..||||.:|.:
  Fly   224 TIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQL 288

  Fly   184 GTYGRYLQEASGTYLPVDACREKLQNQD----DVDLGHVCVQMDAGQGACHGDTGGPLI------ 238
            ......|:.|...: .:|.|:....:||    |..:   |.....|..:|.||:|||||      
  Fly   289 SASNLKLKAAVEGF-RMDECQNVYSSQDILLEDTQM---CAGGKEGVDSCRGDSGGPLIGLDTNK 349

  Fly   239 -DEQQRLVGIGNWG-VPCG-RGYPDVYARTAFYHDWIRTTM 276
             :....|.|:.::| .||| .|:|.||.....|.|||:.|:
  Fly   350 VNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 73/270 (27%)
Tryp_SPc 52..275 CDD:238113 74/272 (27%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 73/270 (27%)
Tryp_SPc 128..389 CDD:238113 74/272 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.