DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG3916

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:82/260 - (31%)
Similarity:128/260 - (49%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQ---NAYSYHLCGAIILDETWVLTAASCV 95
            |||::.  .||...|. |:.||....| ..|:..|:|   .....|.||..|:....|||||.|:
  Fly    16 GLADVV--TSTTESPT-RINGGQRVNE-TVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCM 76

  Fly    96 AGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFD-KPLYHNDIALLQLSS--KIEFNDVTKN 157
            ..::..::.||.||::|......:..|:: |||..:. .|...|||||::::.  ::|.:|:: .
  Fly    77 EKMKVEDVSVVVGTLNWKAGGLRHRLVTK-HVHPQYSMNPRIINDIALVKVTPPFRLERSDIS-T 139

  Fly   158 ITLADIDELEEGDKLTFAGWGS---SEAMGTYGRYLQEASGTYLPVDACREK----LQNQDDVDL 215
            |.:...|.:.|...:...||||   |.:..|....||..:...:..:.|.:|    .:|:     
  Fly   140 ILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQKGFRVTRNE----- 199

  Fly   216 GHVCVQMDAGQGACHGDTGGPLI--DEQQRLVGIGNWG-VPCGRGYPDVYARTAFYHDWIRTTMN 277
              :|.....|||||.||:|||||  .:|..||||.::| ..|.:|.||||.|.:.:..:|...:|
  Fly   200 --ICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVIN 262

  Fly   278  277
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 74/236 (31%)
Tryp_SPc 52..275 CDD:238113 74/238 (31%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 74/236 (31%)
Tryp_SPc 31..260 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.