DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and CG16749

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:243 Identity:77/243 - (31%)
Similarity:118/243 - (48%) Gaps:18/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TEAVPQ-GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVT 107
            :...|| |||:.||.::...:|::.|::.:...|.||..|:.:.:|:|||.|..|.:..:|.|..
  Fly    21 SHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQY 85

  Fly   108 GTVDWWDLYAPYYTVSQIHVHCNFDKPL--YHNDIALLQLSSKIEFNDVTKNITLADIDEL---- 166
            |.............|.:|..|.::: |.  |.|||:||.:....||:.||  :....:.||    
  Fly    86 GVTKINATGPNVVRVKKIIQHEDYN-PYNNYANDISLLLVEEPFEFDGVT--VAPVKLPELAFAT 147

  Fly   167 ---EEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMD-AGQG 227
               :.|.:....|||.:...|.....|||........:.|.|:...:.|... |:|..:| .|:|
  Fly   148 PQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRY-HICGGVDEGGKG 211

  Fly   228 ACHGDTGGPLIDEQQRLVGIGNWGV-PCG-RGYPDVYARTAFYHDWIR 273
            .|.||:|||||...|: |||.:|.: ||. ..||.||.:.:.|.|||:
  Fly   212 QCSGDSGGPLIYNGQQ-VGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 72/232 (31%)
Tryp_SPc 52..275 CDD:238113 73/234 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/232 (31%)
Tryp_SPc 30..259 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.