DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Sp7

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:113/260 - (43%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVIGGTTAAEGNWPWIASIQ---NAYSYHL-CGAIILDETWVLTAASCVAGLRPLNLLVVTGT-- 109
            :|..|...|...:.|:|.::   |.....| ||..:::..:|||||.||.|.....:..:|..  
  Fly   136 KVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRL 200

  Fly   110 --------VDWWD--LYAPYYT--VSQIHVHCNFDKPLYHN---DIALLQLSSKIEFNDVTKNIT 159
                    ||..|  ...|...  :.|..||..:| |...|   |||||:|...:..|:..:.:.
  Fly   201 GEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYD-PANKNRIHDIALLRLDRPVVLNEYIQPVC 264

  Fly   160 LADID---ELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPV---DACREKLQNQDDVDL--G 216
            |..:.   .:..|:.|..:|||.:    |..|.........|||   |.|..|...: ::.|  .
  Fly   265 LPLVSTRMAINTGELLVVSGWGRT----TTARKSTIKQRLDLPVNDHDYCARKFATR-NIHLISS 324

  Fly   217 HVCVQMDAGQGACHGDTGGPLI----DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
            .:||..:..:.:|.||:||||:    |:.....|:.::|..|| .|:|.||.|.|.|.|||..|:
  Fly   325 QLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETI 389

  Fly   277  276
              Fly   390  389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 72/254 (28%)
Tryp_SPc 52..275 CDD:238113 74/256 (29%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 72/254 (28%)
Tryp_SPc 137..388 CDD:238113 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.