DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Try10

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:241 Identity:68/241 - (28%)
Similarity:112/241 - (46%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAG-----LRPLNLLV 105
            |....:::||.|..|.:.|:..|:.:  .||.||..:::|.||::||.|...     |...|:.|
  Rat    18 AADDDKIVGGYTCQENSVPYQVSLNS--GYHFCGGSLINEQWVVSAAHCYKSRIQVRLGEHNINV 80

  Fly   106 VTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD 170
            :.|.       ..:...::|..|.||.:...:|||.|::|||.::.|.....:.|.. .....|.
  Rat    81 LEGN-------EQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATVALPS-SCAPAGT 137

  Fly   171 KLTFAGWGSSEAMG-TYGRYLQEASGTYLPVDACREKLQNQ--DDVDLGHVCVQ-MDAGQGACHG 231
            :...:|||::.:.| .....||......||...|......:  |::    ||.. ::.|:.:|.|
  Rat   138 QCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM----VCAGFLEGGKDSCQG 198

  Fly   232 DTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTM 276
            |:|||::...: |.||.:||..|. ...|.||.:...|.|||:.|:
  Rat   199 DSGGPVVCNGE-LQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 64/230 (28%)
Tryp_SPc 52..275 CDD:238113 66/232 (28%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 64/230 (28%)
Tryp_SPc 24..242 CDD:238113 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.