DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and C1rl

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001002804.2 Gene:C1rl / 408246 RGDID:1302936 Length:488 Species:Rattus norvegicus


Alignment Length:286 Identity:81/286 - (28%)
Similarity:117/286 - (40%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RMRGEPLPGLANIERHRSTEAVPQ-GRVI----------GGTTAAEGNWPWIA--SIQNAYSYHL 77
            |.|||.:|           |.||. ||.:          |.:.|..||:||.|  ||     |..
  Rat   215 RQRGEEVP-----------ECVPVCGRPVVPIAENPNTFGSSRAKPGNFPWQAFTSI-----YGR 263

  Fly    78 CGAIILDETWVLTAASCVAGLRPLNLL------VVTGTVDWWDLY-APYYTVSQIHVHCNFDKPL 135
            .|..:|.:.|:||||..:.....:.|.      |..|..|..:|. ...:.|.::.||.::.:..
  Rat   264 GGGALLGDRWILTAAHTIFPKDSIYLRKNKTVNVFLGHTDVDELLKLGNHPVRRVVVHPDYRQEE 328

  Fly   136 YHN---DIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAG-WGSSEAMGT-YGRYLQEASG 195
            .||   |||||:|..::........:.|.|      .:.|..:| ||.....|. .|....:...
  Rat   329 SHNFDGDIALLELEHRVPLGPSLLPVCLPD------NETLYHSGLWGYISGFGVEMGWLTTKLKY 387

  Fly   196 TYLPV---DACREKLQNQDDVDL---GHVCV--QMDAGQGACHGDTGGPLI---DEQQRLV--GI 247
            :.|||   :||...|:.:...::   ...||  :|.. ...|.||:|...:   |...|.|  ||
  Rat   388 SKLPVAPREACEAWLRQRQRTEVFSDNMFCVGEEMQV-NSVCQGDSGSVYVVWDDRALRWVATGI 451

  Fly   248 GNWGVPCGRGYPDVYARTAFYHDWIR 273
            .:|||.||:|| ..|.:...|.|||:
  Rat   452 VSWGVGCGKGY-GFYTKVLSYVDWIK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/257 (27%)
Tryp_SPc 52..275 CDD:238113 71/259 (27%)
C1rlNP_001002804.2 CUB 55..164 CDD:238001
Tryp_SPc 243..476 CDD:238113 70/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.