DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:239 Identity:78/239 - (32%)
Similarity:113/239 - (47%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQG-RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASC-VAGLRPLNLLVVTGTV 110
            |.| :|.||..|.||.|||.||:|. .:.|.|||.::..:|::|||.| |....|.:..|..|.:
  Rat   182 PGGHKVAGGQDAEEGEWPWQASLQQ-NNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGFL 245

  Fly   111 DWWDLYAP--YYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEE----G 169
                |..|  ...|..|.:|.|:..|.::||||:::|||.:.:.:   ||..|.:.|..:    .
  Rat   246 ----LSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYEN---NIRRACLPEATQKFPPN 303

  Fly   170 DKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ-GACHGDT 233
            ..:...|||:.::.|.....||:.....:....|.........:..|.:|.....|: .||.||:
  Rat   304 SDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDS 368

  Fly   234 GGPLIDEQQR----LVGIGNWGVPCG-RGYPDVYARTAFYHDWI 272
            ||||:.|..:    |.||.:||..|. ...|.||.|...|.|||
  Rat   369 GGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 74/233 (32%)
Tryp_SPc 52..275 CDD:238113 76/234 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 74/233 (32%)
Tryp_SPc 187..415 CDD:238113 76/234 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.