DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31266 and Klk4

DIOPT Version :9

Sequence 1:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:259 Identity:68/259 - (26%)
Similarity:114/259 - (44%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV--- 95
            |...:|...|:.:....|:|.|......:.||.|::.:..:...|..:::...|||:||.|:   
  Rat    14 GYLILEVTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQDS 78

  Fly    96 --AGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHV---HCNFDKPLYHNDIALLQLSSKIEFNDVT 155
              .||...||   .|:.:      |...:.:.|:   |.|::.|.:.||:.|::|:..:..::..
  Rat    79 YTVGLGLHNL---EGSQE------PGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTI 134

  Fly   156 KNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCV 220
            :.|.:|. .....||....:|||..: .|.....||..:.:....:.||  |.......|...| 
  Rat   135 RRIPVAS-QCPTPGDTCLVSGWGRLK-NGKLPSLLQCVNLSVASEETCR--LLYDPVYHLSMFC- 194

  Fly   221 QMDAGQG-----ACHGDTGGPLIDEQ--QRLVGIGNWGVPCGR-GYPDVYARTAFYHDWIRTTM 276
               ||.|     .|:||:|||::..:  |.||.:|..  .||: |.|.||.....:.:||.||:
  Rat   195 ---AGGGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQG--ECGQPGIPSVYTNLCKFTNWIWTTI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 61/236 (26%)
Tryp_SPc 52..275 CDD:238113 62/238 (26%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.